If you have been reading about mass spectrometry and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-08-01. Numbers and descriptions here follow the published literature rather than marketing material.
Common synonyms in catalogs include pentadecapeptide BPC 157, BPC157, and the full sequence name. A CAS registry number in the 137525-51-0 range is frequently listed, though the assignment should be verified against the supplier certificate of analysis. The name itself is not a pharmacopoeial designation, and there is no standardized international nonproprietary name. Distinguishing genuine material from related fragments generally requires mass spectrometry, since several truncated sequences share similar chromatographic behavior.
BPC-157 is a synthetic pentadecapeptide whose sequence is commonly given as Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. It is described in the literature as a fragment of a larger protein found in human gastric juice, referred to as body protection compound. The peptide was first characterized in the early 1990s by a research group in Zagreb, Croatia. Its molecular formula is C62H98N16O22 and its monoisotopic mass is approximately 1419 daltons.
Supplied material is typically a lyophilized white to off-white powder. The peptide is freely soluble in water and in common aqueous buffers, which allows it to be handled as a stock solution. Because the sequence contains no cysteine, disulfide cross-linking is not a route of degradation. The absence of aromatic residues means ultraviolet absorbance at 280 nm is minimal, so quantification usually relies on peptide bond absorbance near 214 nm or on amino acid analysis.
Evidence in humans is limited. Small clinical studies have examined the peptide in contexts such as ulcerative colitis and wound healing, but participant numbers are small and independent replication is scarce. It is not approved as a medicine by major regulatory agencies and is distributed mainly as a research material or compounded preparation. Long-term human safety data are not established, and questions about absorption through non-injected routes remain open rather than resolved. Claims about its effects are best read against these gaps.
BPC-157 is a synthetic peptide of fifteen amino acids, written in single-letter code as GEPPPGKPADDAGLV. The sequence corresponds to a partial fragment of a protein isolated from human gastric juice, described in early reports as body protection compound. The number 157 refers to a fragment designation in that work rather than to molecular mass. Initial descriptions appeared in the early 1990s, when the fragment was reported to protect gastrointestinal tissue in animal models. Commercial material is produced by solid-phase peptide synthesis rather than extracted from biological sources.
Laboratory research on this peptide has examined a wide and heterogeneous set of endpoints, including gastric ulcer models, tendon and ligament injury, wound closure, and intestinal inflammation. Most published findings come from rodent studies, and reported effect sizes are often large relative to controls. Because the compound has been tested across many unrelated injury models, the literature is frequently described as unusually broad for a single peptide. A substantial share of this work originates from a small number of research groups, which matters when assessing how widely results have been reproduced.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white lyophilized powder | Assessed by visual inspection under ordinary laboratory lighting |
| Molecular mass | Approximately 1419 Da | Monoisotopic mass for the fifteen-residue sequence |
| Solubility class | Freely soluble in water | Stock solutions commonly prepared in water or aqueous buffer |
| Typical storage temperature | -20 °C or below, desiccated | Lyophilized powder; repeated freeze-thaw cycles are usually avoided |
| Common analytical method | Reversed-phase HPLC with UV detection | Frequently paired with mass spectrometry to confirm identity |
Identity and purity are established with complementary methods rather than one test. Reverse-phase high-performance liquid chromatography separates the main peak from deletion sequences and oxidized variants, and its area percentage is the usual purity figure. Mass spectrometry confirms the expected molecular mass and can flag truncations or modifications that chromatography alone might miss. Amino acid analysis and peptide mapping add sequence-level confirmation, while residual counter-ion and water content are measured separately.
A freeze-dried sample is generally the most stable form and is commonly held at minus twenty degrees Celsius or lower for long-term keeping, with brief transfers at room temperature. The solid is hygroscopic, so vials are warmed to ambient temperature before opening to prevent condensation from degrading the contents. Light exposure and repeated temperature cycling are both avoided in routine handling. Storage over a desiccant is a common laboratory practice that limits moisture uptake during repeated access.
Once dissolved, the material is considerably less stable than the dry solid. Aqueous solutions are usually kept cold and used within a short window, and neutral or mildly acidic buffers are preferred over strongly alkaline conditions. Freeze-thaw cycles promote aggregation and loss of material to container surfaces, so dividing a batch into single-use aliquots is standard. Adsorption to plastic and glass can lower the measured concentration, meaning solution strength may need rechecking before an experiment.
Purity is ordinarily reported as a percentage from reverse-phase high-performance liquid chromatography, where the area of the main peak is compared with the total peak area. Identity is confirmed by mass spectrometry, since the measured mass can be checked against the value calculated from the sequence. Some certificates also include amino acid analysis or sequence confirmation by tandem mass spectrometry. A single purity number does not describe the profile of related impurities, so the underlying chromatogram and spectrum usually carry more information than the headline figure.
Material of this kind is sold for laboratory research, and labels typically state that it is not intended for human or veterinary use. In many countries it is not an approved medicine, and sports antidoping rules place it among prohibited non-approved substances. Buyers commonly review a certificate of analysis, an independent test report, and the declared storage conditions. Batch-to-batch variation in purity and in counterion content is possible, and how much that variation affects experimental outcomes remains an open question.
Lyophilized peptide is normally kept at minus twenty degrees Celsius or colder, away from light and moisture. Powder held under those conditions is widely treated as stable for long periods, although published stability studies for this exact sequence are sparse and often come from suppliers rather than independent laboratories. Once dissolved, solutions are generally handled cold and used within a short window, because peptide bonds can hydrolyze over time. Repeated freeze-thaw cycles are usually avoided to limit losses, and exact shelf-life figures depend on the buffer and the concentration involved.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography, often paired with mass spectrometry using electrospray or MALDI ionisation. Amino acid analysis and peptide mapping by enzymatic digestion provide additional sequence-level confirmation. Purity is commonly reported as an area percentage from a chromatographic trace, and water content can be measured by Karl Fischer titration. Reported masses may differ by tens of daltons between sources because preparations can contain acetate or trifluoroacetate counterions, and such differences are not by themselves evidence of a different peptide.
BPC-157 is normally distributed as a lyophilised powder that ranges from white to off-white in appearance. The peptide dissolves readily in water, normal saline, and common aqueous buffers, and it is poorly soluble in nonpolar solvents such as hexane or vegetable oils. Lyophilised vials take up moisture if left open, which changes the mass of powder in the container and complicates any later weighing. Because the material is handled in small quantities, static and adhesion to glass or plastic can also cause noticeable losses during transfer.
Dry powder is generally stored at low temperature, with minus twenty degrees Celsius or colder advised for extended retention. Reconstituted solutions are less stable than the solid form and are normally kept cold and shielded from repeated freeze-thaw cycles. Light exposure is avoided because some peptides degrade under ultraviolet radiation. The exact rate of degradation depends on concentration, pH, and the presence of salts, so a single shelf life does not apply to every preparation. Reported stability figures should be read as indicative of typical handling rather than as universal constants.
Confirmation of identity and purity relies on standard peptide analysis techniques. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and serves as the most common purity assay. Mass spectrometry, often coupled to that chromatography step, provides an accurate molecular mass that can be matched against the expected value. Amino acid analysis or sequencing can be added for further confirmation. Because short peptides can be produced by different synthetic routes, laboratories usually report both a chromatographic purity percentage and a mass confirmation rather than a single figure.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
eggNOG GreenPhylDB for plants InParanoid focuses on pairwise ortholog relationships OHNOLOGS is a repository of the genes retained from whole genome duplications in the vertebrate genomes including human and mouse. OMA OrthoDB appreciates that the orthology concept is relative to different speciation points by providing a hierarchy of orthologs along the species tree. OrthoInspector Archived 2020-01-27 at the Wayback Machine is a repository of orthologous genes for 4753 organisms covering the three domains of life OrthologID OrthoMaM for mammals OrthoMCL Roundup SonicParanoid is a graph based method that uses machine learning to reduce execution times and infer orthologs at the domain level. Tree-based phylogenetic approaches aim to distinguish speciation from gene duplication events by comparing gene trees with species trees, as implemented in databases and software tools such as:
Soon after Crick's death, there have been allegations about him having used LSD when he came to the idea of the helix structure of the DNA. While he almost certainly did use LSD, it is unlikely that he did so as early as 1953. In the late 1960s he was given LSD by Henry Todd who met Crick through his girlfriend who had modelled for Crick's wife.
=== PHLWiki === In June 2006, Planet Half-Life began its own wiki project based on MediaWiki. The PHLWiki contained over a hundred articles dealing with fictional Half-Life characters, creatures and locations in an in-universe, encyclopedic form as well as real life articles on mods, player terminology and strategy guides. Before being announced publicly, most of the existing pages, particularly articles making up the fictional encyclopedia, were written by PHL staff writers. The PHLWiki has since shut down.
== Localisation and precursors == Systemin and AtPEP1 are found in the cell cytosol. The precursor to tomato systemin is transcribed as a 200 amino acid polypeptide. It does not contain a putative signal sequence suggesting that it is synthesised on free ribosomes in the cytosol. The precursor to AtPEP1 is a 92 amino acid polypeptide and also lacks a signal sequence. In tomato, mRNA encoding the precursor for systemin is present at very low levels in unwounded leaves but accumulates upon wounding, particularly in the cells surrounding the sieve elements of the phloem in vascular bundles of mid veins. The precursor accumulates exclusively in the phloem parenchyma cells of leaves in tomato after wounding. The precursor to potato systemin is also localised in a similar manner suggesting it is under the same cell-type-specific regulation in both species. HypSys are localised in the cell wall. The precursor for tobacco HypSys is transcribed as a 165 amino acid polypeptide which has no structural homology to the precursor for systemin in tomato. The structural properties of HypSys, containing hydroxyproline and being glycosylated, indicate that they are synthesised through the secretory system. The precursor to HypSys in tomato is a 146 amino acid polypeptide, exclusively synthesised within the vascular bundles of leaves and petioles associated with parenchyma cells of phloem bundles. Unlike systemin, it is primarily associated with the cell wall. The precursors to HypSys appear to represent a distinct subfamily of hydroxyproline-rich proteins found in cell walls.
Sources: en.wikipedia.org
NS Otto Hahn, the only European nuclear-powered civilian ship (1964); a crater on the Moon (shared with his namesake Friedrich von Hahn); and the asteroid 19126 Ottohahn; the Otto Hahn Prize of both the German Chemical and Physical Societies and the city of Frankfurt/Main; the Otto Hahn Medal – An Incentive for Young Scientists – and the Otto Hahn Award of the Max Planck Society; and the Otto Hahn Peace Medal in Gold of the United Nations Association of Germany (DGVN) in Berlin (1988). Proposals were made at various times, first in 1971 by American chemists, that the newly synthesised element 105 should be named hahnium in Hahn's honour, but in 1997 the IUPAC named it dubnium, after the Russian research centre in Dubna. In 1992 element 108 was discovered by a German research team, and they proposed the name hassium (after Hesse). In spite of the long-standing convention to give the discoverer the right to suggest a name, a 1994 IUPAC committee recommended that it be named hahnium. After protests from the German discoverers, the name hassium (Hs) was adopted internationally in 1997.
== Biosynthetic mechanism == Hyaluronic acid (HA) is a linear glycosaminoglycan (GAG), an anionic, gel-like, polymer, found in the extracellular matrix of epithelial and connective tissues of vertebrates. It is part of a family of structurally complex, linear, anionic polysaccharides. The carboxylate groups present in the molecule make it negatively charged, therefore allowing for successful binding to water, and making it valuable to cosmetic and pharmaceutical products. HA consists of repeating β4-glucuronic acid (GlcUA)-β3-N-acetylglucosamine (GlcNAc) disaccharides, and is synthesized by hyaluronan synthases (HAS), a class of integral membrane proteins that produce the well-defined, uniform chain lengths characteristic to HA. There are three existing types of HASs in vertebrates: HAS1, HAS2, HAS3; each of these contribute to elongation of the HA polymer. For an HA capsule to be created, this enzyme must be present because it polymerizes UDP-sugar precursors into HA. HA precursors are synthesized by first phosphorylating glucose by hexokinase, yielding glucose-6-phosphate, which is the main HA precursor. Then, two routes are taken to synthesize UDP-n-acetylglucosamine and UDP-glucuronic acid which both react to form HA. Glucose-6-phosphate gets converted to either fructose-6-phosphate with hasE (phosphoglucoisomerase), or glucose-1-phosphate using pgm (α-phosphoglucomutase), where those both undergo different sets of reactions. UDP-glucuronic acid and UDP-n-acetylglucosamine get bound together to form HA via hasA (HA synthase).
== History == Bodybuilding.com grew out of wholesale-creatine.com, an online storefront created by teenage web marketer and amateur bodybuilder Ryan DeLuca in 1997, to capitalize on the rising popularity of creatine supplements. A majority stake in Bodybuilding.com was acquired in July 2006 by Milestone Partners for an undisclosed amount. In 2007, an FDA agent purchased several supplements from Bodybuilding.com which were determined to contain anabolic steroids. In May 2012, the company was fined $7 million, and as part of the settlement, CEO DeLuca and his brother Jeremy were both fined $600,000 for selling misbranded drugs. In January 2008, Liberty Media Corporation acquired a controlling stake in Bodybuilding.com for more than $100 million. DeLuca stayed on as the company's CEO.
=== Subsequent history === In 2008, SPUSA candidate for President Brian Moore vocally opposed the idea that Barack Obama was a socialist of any kind, saying it was "misleading of the Republicans" to spread that message. In 2009, the Socialist Party of Connecticut protested in Hartford against Obama's troop surge in Afghanistan. In 2010, SPUSA Co-Chair Billy Wharton called Obama's 2010 State of the Union Address a "public relations ploy". Wharton criticized the Affordable Care Act as designed "to protect the profit margins of private insurance companies". In 2012, SPUSA member Pat Noble was elected to the Red Bank Regional High School Board of Education. Noble ran openly as a Socialist, despite the race being nonpartisan.
=== Sulfonating agent === Sulfur trioxide is a potent sulfonating agent, i.e. it adds SO3 groups to substrates. Often the substrates are organic, as in aromatic sulfonation. For activated substrates, Lewis base adducts of sulfur trioxide are effective sulfonating agents.
Sources: en.wikipedia.org
It is a synthetic peptide built from fifteen amino acids, with a mass of roughly 1419 daltons. The sequence is reported to match a fragment of a protein present in human gastric juice. It is not a naturally circulating hormone.
It is normally supplied as a lyophilized powder in a sealed vial. The powder dissolves readily in water, and stock solutions are typically prepared shortly before use. Cold storage is standard laboratory practice.
The letters are generally read as shorthand for body protection compound. That label comes from the original research context rather than from formal nomenclature. No standardized nonproprietary name exists for the peptide.
It is a synthetic fifteen-amino-acid peptide whose sequence matches part of a protein found in human gastric juice. It is made by chemical synthesis, not purified from tissue. The name derives from an early fragment label, not from a molecular weight.